Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated, Yeast

Artikelnummer: BIM-RPC25132
Artikelname: Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated, Yeast
Artikelnummer: BIM-RPC25132
Hersteller Artikelnummer: RPC25132
Alternativnummer: BIM-RPC25132-20UG,BIM-RPC25132-100UG,BIM-RPC25132-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: KP6 killer toxin, Killer protein 6, Cleaved into: KP6 killer toxin subunit alpha, VP10, KP6 killer toxin subunit beta, VP12.5
Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ustilago maydis P6 virus (UmV6) (UmV-P6). Target Name: Ustilago maydis P6 virus KP6 killer toxin. Target Synonyms: KP6 killer toxin, Killer protein 6, Cleaved into: KP6 killer toxin subunit alpha, VP10, KP6 killer toxin subunit beta, VP12.5. Accession Number: P16948. Expression Region: 28~105aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 10.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
Target-Kategorie: Ustilago maydis P6 virus KP6 killer toxin