Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated, Yeast

Artikelnummer: BIM-RPC25134
Artikelname: Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated, Yeast
Artikelnummer: BIM-RPC25134
Hersteller Artikelnummer: RPC25134
Alternativnummer: BIM-RPC25134-20UG,BIM-RPC25134-100UG,BIM-RPC25134-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Type I DHQase
Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Salmonella typhi. Target Name: aroD. Target Synonyms: Type I DHQase. Accession Number: P24670. Expression Region: 1~252aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 29.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Target-Kategorie: aroD