Recombinant Ambrosia artemisiifolia Pectate lyase 5, Unconjugated, Yeast

Artikelnummer: BIM-RPC25142
Artikelname: Recombinant Ambrosia artemisiifolia Pectate lyase 5, Unconjugated, Yeast
Artikelnummer: BIM-RPC25142
Hersteller Artikelnummer: RPC25142
Alternativnummer: BIM-RPC25142-20UG,BIM-RPC25142-100UG,BIM-RPC25142-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Antigen Amb a IAntigen EAgEPollen allergen Amb a 1.1Allergen: Amb a 1.1
Recombinant Ambrosia artemisiifolia Pectate lyase 5 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ambrosia artemisiifolia (Short ragweed). Target Name: Ambrosia artemisiifolia Pectate lyase 5. Target Synonyms: Antigen Amb a IAntigen EAgEPollen allergen Amb a 1.1Allergen: Amb a 1.1. Accession Number: P27759. Expression Region: 26~396aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AEDLQEILPVNETRRLTTSGAYNIIDGCWRGKADWAENRKALADCAQGFGKGTVGGKDGDIYTVTSELDDDVANPKEGTLRFGAAQNRPLWIIFERDMVIRLDKEMVVNSDKTIDGRGAKVEIINAGFTLNGVKNVIIHNINMHDVKVNPGGLIKSNDGPAAPRAGSDGDAISISGSSQIWIDHCSLSKSVDGLVDAKLGTTRLTVSNSLFTQHQFVLLFGAGDENIEDRGMLATVAFNTFTDNVDQRMPRCRHG
Target-Kategorie: Ambrosia artemisiifolia Pectate lyase 5