Recombinant Streptomyces avidinii Streptavidin, Unconjugated, Yeast

Artikelnummer: BIM-RPC25151
Artikelname: Recombinant Streptomyces avidinii Streptavidin, Unconjugated, Yeast
Artikelnummer: BIM-RPC25151
Hersteller Artikelnummer: RPC25151
Alternativnummer: BIM-RPC25151-20UG,BIM-RPC25151-100UG,BIM-RPC25151-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Streptavidin
Recombinant Streptomyces avidinii Streptavidin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Streptomyces avidinii. Target Name: Streptomyces avidinii Streptavidin. Target Synonyms: Streptavidin. Accession Number: P22629. Expression Region: 25~183aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Target-Kategorie: Streptomyces avidinii Streptavidin