Recombinant Aspergillus niger 3-phytase A (phyA), Unconjugated, Yeast

Artikelnummer: BIM-RPC25158
Artikelname: Recombinant Aspergillus niger 3-phytase A (phyA), Unconjugated, Yeast
Artikelnummer: BIM-RPC25158
Hersteller Artikelnummer: RPC25158
Alternativnummer: BIM-RPC25158-20UG,BIM-RPC25158-100UG,BIM-RPC25158-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: 3 phytase AMyo-inositol hexakisphosphate phosphohydrolase AMyo-inositol-hexaphosphate 3-phosphohydrolase A
Recombinant Aspergillus niger 3-phytase A (phyA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus niger. Target Name: phyA. Target Synonyms: 3 phytase AMyo-inositol hexakisphosphate phosphohydrolase AMyo-inositol-hexaphosphate 3-phosphohydrolase A. Accession Number: P34752. Expression Region: 24~467aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 50.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKL
Target-Kategorie: phyA