Recombinant Lithobates catesbeiana Saxiphilin, Unconjugated, Yeast

Artikelnummer: BIM-RPC25178
Artikelname: Recombinant Lithobates catesbeiana Saxiphilin, Unconjugated, Yeast
Artikelnummer: BIM-RPC25178
Hersteller Artikelnummer: RPC25178
Alternativnummer: BIM-RPC25178-20UG,BIM-RPC25178-100UG,BIM-RPC25178-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Frog
Konjugation: Unconjugated
Alternative Synonym: SAX
Recombinant Lithobates catesbeiana Saxiphilin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: American bullfrog. Target Name: Lithobates catesbeiana Saxiphilin. Target Synonyms: SAX. Accession Number: P31226. Expression Region: 484~844aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKS
Target-Kategorie: Lithobates catesbeiana Saxiphilin