Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated, Yeast

Artikelnummer: BIM-RPC25226
Artikelname: Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated, Yeast
Artikelnummer: BIM-RPC25226
Hersteller Artikelnummer: RPC25226
Alternativnummer: BIM-RPC25226-20UG,BIM-RPC25226-100UG,BIM-RPC25226-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Islet-activating protein S1, IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)
Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251). Target Name: ptxA. Target Synonyms: Islet-activating protein S1, IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-). Accession Number: P04977. Expression Region: 35~269aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Target-Kategorie: ptxA