Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated, Unconjugated, E. coli

Artikelnummer: BIM-RPC27501
Artikelname: Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated, Unconjugated, E. coli
Artikelnummer: BIM-RPC27501
Hersteller Artikelnummer: RPC27501
Alternativnummer: BIM-RPC27501-20UG,BIM-RPC27501-100UG,BIM-RPC27501-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Basic fibroblast growth factor, bFGFHeparin-binding growth factor 2, HBGF-2
Recombinant Human Fibroblast growth factor 2 (FGF2), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FGF2. Target Synonyms: Basic fibroblast growth factor, bFGFHeparin-binding growth factor 2, HBGF-2. Accession Number: P09038. Expression Region: 143~288aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 64.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 64.2kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Target-Kategorie: FGF2