Recombinant Mouse Lymphotoxin-alpha (Lta), Unconjugated, E. coli

Artikelnummer: BIM-RPC27528
Artikelname: Recombinant Mouse Lymphotoxin-alpha (Lta), Unconjugated, E. coli
Artikelnummer: BIM-RPC27528
Hersteller Artikelnummer: RPC27528
Alternativnummer: BIM-RPC27528-20UG,BIM-RPC27528-100UG,BIM-RPC27528-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: TNF-beta, Tumor necrosis factor ligand superfamily member 1
Recombinant Mouse Lymphotoxin-alpha (Lta) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Lta. Target Synonyms: TNF-beta, Tumor necrosis factor ligand superfamily member 1. Accession Number: P09225. Expression Region: 34~202aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 23.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Target-Kategorie: Lta