Recombinant Bovine Peptidoglycan recognition protein 1 (PGLYRP1), Unconjugated, E. coli

Artikelnummer: BIM-RPC27543
Artikelname: Recombinant Bovine Peptidoglycan recognition protein 1 (PGLYRP1), Unconjugated, E. coli
Artikelnummer: BIM-RPC27543
Hersteller Artikelnummer: RPC27543
Alternativnummer: BIM-RPC27543-20UG,BIM-RPC27543-100UG,BIM-RPC27543-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Peptidoglycan recognition protein 1(Oligosaccharide-binding protein, OBP, Peptidoglycan recognition protein short, PGRP-S)
Recombinant Bovine Peptidoglycan recognition protein 1 (PGLYRP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: PGLYRP1. Target Synonyms: Peptidoglycan recognition protein 1(Oligosaccharide-binding protein, OBP, Peptidoglycan recognition protein short, PGRP-S). Accession Number: Q8SPP7. Expression Region: 22~190aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 26.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QDCGSIVSRGKWGALASKCSQRLRQPVRYVVVSHTAGSVCNTPASCQRQAQNVQYYHVRERGWCDVGYNFLIGEDGLVYEGRGWNTLGAHSGPTWNPIAIGISFMGNYMHRVPPASALRAAQSLLACGAARGYLTPNYEVKGHRDVQQTLSPGDELYKIIQQWPHYRRV
Target-Kategorie: PGLYRP1