Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC), Unconjugated, E. coli

Artikelnummer: BIM-RPC27545
Artikelname: Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC), Unconjugated, E. coli
Artikelnummer: BIM-RPC27545
Hersteller Artikelnummer: RPC27545
Alternativnummer: BIM-RPC27545-20UG,BIM-RPC27545-100UG,BIM-RPC27545-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: rotein phosphatase 1C catalytic subunit (PP-1G)
Recombinant Human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PPP1CC. Target Synonyms: rotein phosphatase 1C catalytic subunit (PP-1G). Accession Number: P36873. Expression Region: 2~323aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 44.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
Target-Kategorie: PPP1CC