Recombinant Human Ras-related protein Rab-1A (RAB1A), Unconjugated, E. coli

Artikelnummer: BIM-RPC27547
Artikelname: Recombinant Human Ras-related protein Rab-1A (RAB1A), Unconjugated, E. coli
Artikelnummer: BIM-RPC27547
Hersteller Artikelnummer: RPC27547
Alternativnummer: BIM-RPC27547-20UG,BIM-RPC27547-100UG,BIM-RPC27547-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: YPT1-related protein
Recombinant Human Ras-related protein Rab-1A (RAB1A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RAB1A. Target Synonyms: YPT1-related protein. Accession Number: P62820. Expression Region: 2~205aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 49.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.5kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Target-Kategorie: RAB1A