4F2 light chainCD98 light chainIntegral membrane protein E16L-type amino acid transporter 1Solute carrier family 7 member 5y+ system cationic amino acid transporter
Recombinant Human Large neutral amino acids transporter small subunit 1 (SLC7A5), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SLC7A5. Target Synonyms: 4F2 light chainCD98 light chainIntegral membrane protein E16L-type amino acid transporter 1Solute carrier family 7 member 5y+ system cationic amino acid transporter. Accession Number: Q01650. Expression Region: 16~50aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht:
19.7kDa
Tag:
N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit:
>90% by SDS-PAGE
Sequenz:
AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Target-Kategorie:
SLC7A5
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
