Recombinant Mouse Stanniocalcin-2 (Stc2), Unconjugated, E. coli

Artikelnummer: BIM-RPC27561
Artikelname: Recombinant Mouse Stanniocalcin-2 (Stc2), Unconjugated, E. coli
Artikelnummer: BIM-RPC27561
Hersteller Artikelnummer: RPC27561
Alternativnummer: BIM-RPC27561-20UG,BIM-RPC27561-100UG,BIM-RPC27561-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Stc2, Stanniocalcin-2, STC-2
Recombinant Mouse Stanniocalcin-2 (Stc2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Stc2. Target Synonyms: Stc2, Stanniocalcin-2, STC-2. Accession Number: O88452. Expression Region: 25~296aa. Tag Info: Tag-Free. Theoretical MW: 30.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.1kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPS
Target-Kategorie: Stc2