Recombinant Pyrococcus horikoshii Protein archease (PH1536), Unconjugated, E. coli

Artikelnummer: BIM-RPC27565
Artikelname: Recombinant Pyrococcus horikoshii Protein archease (PH1536), Unconjugated, E. coli
Artikelnummer: BIM-RPC27565
Hersteller Artikelnummer: RPC27565
Alternativnummer: BIM-RPC27565-20UG,BIM-RPC27565-100UG,BIM-RPC27565-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Pyrococcus horikoshii Protein archease (PH1536) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3). Target Name: PH1536. Accession Number: O59205. Expression Region: 1~142aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 24.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKKWEHYEHTADIGIRGYGDSLEEAFEAVAIALFDVMVNVNKVEKKEVREIEVEAEDLEALLYSFLEELLVIHDIEGLVFRDFEVKIERVNGKYRLRAKAYGEKLDLKKHEPKEEVKAITYHDMKIERLPNGKWMAQLVPDI
Target-Kategorie: PH1536