Recombinant E. coli Hemolysin E, chromosomal (hlyE), partial, Unconjugated

Artikelnummer: BIM-RPC27577
Artikelname: Recombinant E. coli Hemolysin E, chromosomal (hlyE), partial, Unconjugated
Artikelnummer: BIM-RPC27577
Hersteller Artikelnummer: RPC27577
Alternativnummer: BIM-RPC27577-20UG,BIM-RPC27577-100UG,BIM-RPC27577-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: Cytotoxin ClyA, Hemolysis-inducing protein, Latent pore-forming 34 kDa hemolysin, Silent hemolysin SheA
Recombinant E. coli Hemolysin E, chromosomal (hlyE), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: hlyE. Target Synonyms: Cytotoxin ClyA, Hemolysis-inducing protein, Latent pore-forming 34 kDa hemolysin, Silent hemolysin SheA. Accession Number: P77335. Expression Region: 2~182aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA
Target-Kategorie: hlyE