Recombinant Mycoplasma pneumoniae Uncharacterized protein MG218.1 homolog (MPN_311), Unconjugated, E. coli

Artikelnummer: BIM-RPC27578
Artikelname: Recombinant Mycoplasma pneumoniae Uncharacterized protein MG218.1 homolog (MPN_311), Unconjugated, E. coli
Artikelnummer: BIM-RPC27578
Hersteller Artikelnummer: RPC27578
Alternativnummer: BIM-RPC27578-20UG,BIM-RPC27578-100UG,BIM-RPC27578-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG218.1 homolog (MPN_311) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Target Name: MPN_311. Accession Number: P75470. Expression Region: 1~357aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTNDYQQLNYLVETDDEADIIIANLVKQLNELKEILLSLDNQDLEINQVNHRTTVHNTSSNTSNNSTSNNIADGNYNSNFFHNFSKETLQTQAKRGFLLLERCSLVGLQQLELEYLNVLGRSFESHQDKINFLVNLRDLTNDHLLDTEKIVSTLEQIFNVIGGTEYTPILNSFFNQSLNDPDPIQREIGLKQFVANLRQRFKTLLQKTNNSIQQLEAEIQIPTTHIKSDEVMFGPPDMNERLVLNDSETDAILRS
Target-Kategorie: MPN_311