Recombinant Pseudomonas putida Phthalate 4, 5-dioxygenase oxygenase subunit (pht3), Unconjugated, E. coli

Artikelnummer: BIM-RPC27587
Artikelname: Recombinant Pseudomonas putida Phthalate 4, 5-dioxygenase oxygenase subunit (pht3), Unconjugated, E. coli
Artikelnummer: BIM-RPC27587
Hersteller Artikelnummer: RPC27587
Alternativnummer: BIM-RPC27587-20UG,BIM-RPC27587-100UG,BIM-RPC27587-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Pseudomonas putida Phthalate 4, 5-dioxygenase oxygenase subunit (pht3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas putida (Arthrobacter siderocapsulatus). Target Name: pht3. Accession Number: Q05183. Expression Region: 1~439aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MLTPEENLLLCRVEGDAPMGQMMRRHWTPVCLLEEVSEPDGTPVRARLFGEDLVVFRDTDGRVGVMDEYCPHRRVSLIYGRNENSGLRCLYHGWKMDVDGNVVEMVSEPAASNMCQKVKHTAYKTREWGGFVWAYMGPQDAIPEFVPPAWAPHEHVRVSIAKAIIPCNWAQILEGAIDSAHSSSLHSSDFVPARVGGAEATSKNWLRPSTDKAPRMQVERTSYGFRYAALRRPIQNAATSEYVRSTVFVAPATAL
Target-Kategorie: pht3