Recombinant Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a, Unconjugated, E. coli

Artikelnummer: BIM-RPC27593
Artikelname: Recombinant Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a, Unconjugated, E. coli
Artikelnummer: BIM-RPC27593
Hersteller Artikelnummer: RPC27593
Alternativnummer: BIM-RPC27593-20UG,BIM-RPC27593-100UG,BIM-RPC27593-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Dermonecrotic toxin 1 (LiRecDT1, Sphingomyelin phosphodiesterase D 1, SMD 1, SMase D 1, Sphingomyelinase D 1, PLD)
Recombinant Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Loxosceles intermedia (Brown spider). Target Name: Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a. Target Synonyms: Dermonecrotic toxin 1 (LiRecDT1, Sphingomyelin phosphodiesterase D 1, SMD 1, SMase D 1, Sphingomyelinase D 1, PLD). Accession Number: P0CE80. Expression Region: 27~306aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AGNRRPIWIMGHMVNAIGQIDEFVNLGANSIETDVSFDDNANPEYTYHGIPCDCGRNCKKYENFNDFLKGLRSATTPGNSKYQEKLVLVVFDLKTGSLYDNQANDAGKKLAKNLLQHYWNNGNNGGRAYIVLSIPDLNHYPLIKGFKDQLTKDGHPELMDKVGHDFSGNDDIGDVGKAYKKAGITGHIWQSDGITNCLPRGLSRVNAAVANRDSANGFINKVYYWTVDKRSTTRDALDAGVDGIMTNYPDVITDV
Target-Kategorie: Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a