Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1), Unconjugated, E. coli

Artikelnummer: BIM-RPC27594
Artikelname: Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1), Unconjugated, E. coli
Artikelnummer: BIM-RPC27594
Hersteller Artikelnummer: RPC27594
Alternativnummer: BIM-RPC27594-20UG,BIM-RPC27594-100UG,BIM-RPC27594-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: 33 kDa early proteinp33
Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4). Target Name: BARF1. Target Synonyms: 33 kDa early proteinp33. Accession Number: P0CW72. Expression Region: 21~221aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYLSQ
Target-Kategorie: BARF1