Recombinant Bovine coronavirus Nucleoprotein (N), Unconjugated, E. coli

Artikelnummer: BIM-RPC27601
Artikelname: Recombinant Bovine coronavirus Nucleoprotein (N), Unconjugated, E. coli
Artikelnummer: BIM-RPC27601
Hersteller Artikelnummer: RPC27601
Alternativnummer: BIM-RPC27601-20UG,BIM-RPC27601-100UG,BIM-RPC27601-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Nucleocapsid protein (NC, Protein N)
Recombinant Bovine coronavirus Nucleoprotein (N) is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus(strain Mebus)(BCoV)(BCV). Target Name: N. Target Synonyms: Nucleocapsid protein (NC, Protein N). Accession Number: P10527. Expression Region: 1~448aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 55.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSFTPGKQSSSRASFGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQLPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVT
Target-Kategorie: N