Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27608
Artikelname: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27608
Hersteller Artikelnummer: RPC27608
Alternativnummer: BIM-RPC27608-20UG,BIM-RPC27608-100UG,BIM-RPC27608-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Pre-GP-C (GP-C)
Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lassa virus(strain GA391)(LASV). Target Name: GPC. Target Synonyms: Pre-GP-C (GP-C). Accession Number: P17332. Expression Region: 59~258aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LIYKGTYELQTLELNMETLNMTMPLSCTKNNSHHYIRVGNETGLELTLTNTSILNHKFCNLSDAHKRNLYDHSLMSIISTFHLSIPNFNQYEAMSCDFNGGKITVQYNLSHSFAVDAAGHCGTLANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWDDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
Target-Kategorie: GPC