Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21), Unconjugated, E. coli

Artikelnummer: BIM-RPC27619
Artikelname: Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21), Unconjugated, E. coli
Artikelnummer: BIM-RPC27619
Hersteller Artikelnummer: RPC27619
Alternativnummer: BIM-RPC27619-20UG,BIM-RPC27619-100UG,BIM-RPC27619-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: 25.3 kDa heat shock protein, chloroplastic
Recombinant Arabidopsis thaliana Heat shock protein 21, chloroplastic (HSP21) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: HSP21. Target Synonyms: 25.3 kDa heat shock protein, chloroplastic. Accession Number: P31170. Expression Region: 44~227aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ
Target-Kategorie: HSP21