Recombinant Venezuelan equine encephalitis virus Polyprotein P1234, Unconjugated, E. coli

Artikelnummer: BIM-RPC27622
Artikelname: Recombinant Venezuelan equine encephalitis virus Polyprotein P1234, Unconjugated, E. coli
Artikelnummer: BIM-RPC27622
Hersteller Artikelnummer: RPC27622
Alternativnummer: BIM-RPC27622-20UG,BIM-RPC27622-100UG,BIM-RPC27622-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Non-structural polyprotein
Recombinant Venezuelan equine encephalitis virus Polyprotein P1234 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Venezuelan equine encephalitis virus (strain 3880) (VEEV). Target Name: Venezuelan equine encephalitis virus Polyprotein P1234. Target Synonyms: Non-structural polyprotein. Accession Number: P36327. Expression Region: 2028~2475aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 55.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MVDGASCCLDTASFCPAKLRSFPKKHSYLEPTIRSAVPSAIQNTLQNVLAAATKRNCNVTQMRELPVLDSAAFNVECFKKYACNNEYWETFKENPIRLTEENVVNYITKLKGPKAAALFAKTHNLNMLQDIPMDRFVMDLKRDVKVTPGTKHTEERPKVQVIQAADPLATAYLCGIHRELVRRLNAVLLPNIHTLFDMSAEDFDAIIAEHFQPGDCVLETDIASFDKSEDDAMALTALMILEDLGVDAELLTLIE
Target-Kategorie: Venezuelan equine encephalitis virus Polyprotein P1234