Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ), Unconjugated, E. coli

Artikelnummer: BIM-RPC27629
Artikelname: Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ), Unconjugated, E. coli
Artikelnummer: BIM-RPC27629
Hersteller Artikelnummer: RPC27629
Alternativnummer: BIM-RPC27629-20UG,BIM-RPC27629-100UG,BIM-RPC27629-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Haemophilus influenzae Putative toxin YafQ (yafQ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd). Target Name: yafQ. Accession Number: P44041. Expression Region: 1~102aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 19.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIHCLLNRLPLPENYQDHALVGEWKGYRDCHIQGDLVLIYQYVIQDEFDELKFSRLNIHSQTALK
Target-Kategorie: yafQ