Recombinant Arachis hypogaea Allergen Arachin Arah3 isoform, Unconjugated, E. coli

Artikelnummer: BIM-RPC27647
Artikelname: Recombinant Arachis hypogaea Allergen Arachin Arah3 isoform, Unconjugated, E. coli
Artikelnummer: BIM-RPC27647
Hersteller Artikelnummer: RPC27647
Alternativnummer: BIM-RPC27647-20UG,BIM-RPC27647-100UG,BIM-RPC27647-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Recombinant Arachis hypogaea Allergen Arachin Arah3 isoform is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arachis hypogaea (Peanut). Target Name: Arachis hypogaea Allergen Arachin Arah3 isoform. Accession Number: B5TYU1. Expression Region: 21~530aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 62.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 62.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ISFRQQPEENACQFQRLNAQRPDNRIESEGGYIETWNPNNQEFECAGVALSRLVLRRNALRRPFYSNAPQEIFIQQGRGYFGLIFPGCPSTYEEPAQQGRRYQSQRPPRRLQEEDQSQQQQDSHQKVHRFNEGDLIAVPTGVAFWLYNDHDTDVVAVSLTDTNNNDNQLDQFPRRFNLAGNHEQEFLRYQQQSRQSRRRSLPYSPYSPQSQPRQEEREFSPRGQHSRRERAGQEEENEGGNIFSGFTPEFLAQAF
Target-Kategorie: Arachis hypogaea Allergen Arachin Arah3 isoform