Recombinant Legionella longbeachae Outer membrane protein MIP (mip), Unconjugated, E. coli

Artikelnummer: BIM-RPC27651
Artikelname: Recombinant Legionella longbeachae Outer membrane protein MIP (mip), Unconjugated, E. coli
Artikelnummer: BIM-RPC27651
Hersteller Artikelnummer: RPC27651
Alternativnummer: BIM-RPC27651-20UG,BIM-RPC27651-100UG,BIM-RPC27651-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Macrophage infectivity potentiatorPeptidyl-prolyl cis-trans isomeraseRotamase
Recombinant Legionella longbeachae Outer membrane protein MIP (mip) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Legionella longbeachae. Target Name: mip. Target Synonyms: Macrophage infectivity potentiatorPeptidyl-prolyl cis-trans isomeraseRotamase. Accession Number: P53605. Expression Region: 21~233aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ATDATSLTTDKDKLSYSIGADLGKNFKNQGIDINPDVLAKGMQDGMSGAQLILTEEQMKDVLSKFQKDLMAKRSAEFNKKAEENKAKGDAFLSANKSKPGIVVLPSGLQYKIIDAGTGAKPGKSDTVTVEYTGTLIDGTVFDSTEKAGKPATFQVSQVIPGWTEALQLMPAGSTWEVFVPADLAYGPRSVGGPIGPNETLIFKIHLISVKKAA
Target-Kategorie: mip