Recombinant Neisseria meningitidis serogroup B DNA-binding protein HU-beta (hupB), Unconjugated, E. coli

Artikelnummer: BIM-RPC27653
Artikelname: Recombinant Neisseria meningitidis serogroup B DNA-binding protein HU-beta (hupB), Unconjugated, E. coli
Artikelnummer: BIM-RPC27653
Hersteller Artikelnummer: RPC27653
Alternativnummer: BIM-RPC27653-20UG,BIM-RPC27653-100UG,BIM-RPC27653-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Neisseria meningitidis serogroup B DNA-binding protein HU-beta (hupB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B (strain MC58). Target Name: hupB. Accession Number: P64389. Expression Region: 1~89aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 15.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.4kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MNKSELIEAIAQEADISKAAAQKALDATTNAVTTALKQGDTVTLVGFGTFYVGERAERQGRNPKTGEPLTIAAAKTPKFRAGKALKDAL
Target-Kategorie: hupB