Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR), Unconjugated, E. coli

Artikelnummer: BIM-RPC27663
Artikelname: Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR), Unconjugated, E. coli
Artikelnummer: BIM-RPC27663
Hersteller Artikelnummer: RPC27663
Alternativnummer: BIM-RPC27663-20UG,BIM-RPC27663-100UG,BIM-RPC27663-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: regA
Recombinant Pseudomonas aeruginosa Exotoxin A regulatory protein (toxR) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1). Target Name: toxR. Target Synonyms: regA. Accession Number: P09852. Expression Region: 1~259aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 44.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.2kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTATDRTPPPLKWLCLGNRDANDGFELFAHGIYARNGALVGSKLSLRERRQRVDLSAFLSGAPPLLAEAAVKHLLARLLCVHRHNTDLELLGKNFIPLHASSLGNAGVCERILASARQLQQHQVELCLLLAIDEQEPASAEYLTSLARLRDSGVRIALHPQRIDTDARQCFAEVDAGLCDYLGLDARLLAPGPLTRNLRQRKSIEYLNRLLVAQDIQMLCLNVDNEELHQQANALPFAFRHGRHYSEPFQAWPFS
Target-Kategorie: toxR