Recombinant Neisseria meningitidis serogroup B Integration host factor subunit beta (ihfB), Unconjugated, E. coli

Artikelnummer: BIM-RPC27664
Artikelname: Recombinant Neisseria meningitidis serogroup B Integration host factor subunit beta (ihfB), Unconjugated, E. coli
Artikelnummer: BIM-RPC27664
Hersteller Artikelnummer: RPC27664
Alternativnummer: BIM-RPC27664-20UG,BIM-RPC27664-100UG,BIM-RPC27664-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Recombinant Neisseria meningitidis serogroup B Integration host factor subunit beta (ihfB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup B (strain MC58). Target Name: ihfB. Accession Number: P0A0U2. Expression Region: 1~104aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 17.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.8kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN
Target-Kategorie: ihfB