Recombinant Human variant SIRP alpha (SIRPA), Unconjugated, E. coli

Artikelnummer: BIM-RPC27666
Artikelname: Recombinant Human variant SIRP alpha (SIRPA), Unconjugated, E. coli
Artikelnummer: BIM-RPC27666
Hersteller Artikelnummer: RPC27666
Alternativnummer: BIM-RPC27666-20UG,BIM-RPC27666-100UG,BIM-RPC27666-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Brain Ig-like molecule with tyrosine-based activation motifs, BitCD172 antigen-like family member AInhibitory receptor SHPS-1Macrophage fusion receptorMyD-1 antigen, Signal-regulatory protein alpha-1, Sirp-alpha-1Signal-regulatory protein alpha-2, Sirp-alpha-2Signal-regulatory protein alpha-3, Sirp-alpha-3p84, CD172a
Recombinant Human variant SIRP alpha (SIRPA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SIRPA. Target Synonyms: Brain Ig-like molecule with tyrosine-based activation motifs, BitCD172 antigen-like family member AInhibitory receptor SHPS-1Macrophage fusion receptorMyD-1 antigen, Signal-regulatory protein alpha-1, Sirp-alpha-1Signal-regulatory protein alpha-2. Accession Number: P78324. Expression Region: 1~131aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MEEELQIIQPDKSVLVAAGETATLRCTITSLFPVGPIQWFRGAGPGRVLIYNQRQGPFPRVTTVSDTTKRNNMDFSIRIGNITPADAGTYYCIKFRKGSPDDVEFKSGAGTELSVRAKPVDGGFLGGGGCG
Target-Kategorie: SIRPA