Recombinant Human rhinovirus A serotype 89 Genome polyprotein, Biotinylated, Unconjugated, E. coli

Artikelnummer: BIM-RPC27677
Artikelname: Recombinant Human rhinovirus A serotype 89 Genome polyprotein, Biotinylated, Unconjugated, E. coli
Artikelnummer: BIM-RPC27677
Hersteller Artikelnummer: RPC27677
Alternativnummer: BIM-RPC27677-20UG,BIM-RPC27677-100UG,BIM-RPC27677-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: 3D polymeraseProtein 3D
Recombinant Human rhinovirus A serotype 89 Genome polyprotein, Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89). Target Name: Human rhinovirus A serotype 89 Genome polyprotein, Biotinylated. Target Synonyms: 3D polymeraseProtein 3D. Accession Number: P07210. Expression Region: 575~866aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 80.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 80.4kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRP
Target-Kategorie: Human rhinovirus A serotype 89 Genome polyprotein, Biotinylated