Recombinant E. coli 3-phosphoshikimate 1-carboxyvinyltransferase (aroA), Unconjugated

Artikelnummer: BIM-RPC27680
Artikelname: Recombinant E. coli 3-phosphoshikimate 1-carboxyvinyltransferase (aroA), Unconjugated
Artikelnummer: BIM-RPC27680
Hersteller Artikelnummer: RPC27680
Alternativnummer: BIM-RPC27680-20UG,BIM-RPC27680-100UG,BIM-RPC27680-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: 5-enolpyruvylshikimate-3-phosphate synthase (EPSP synthase, EPSPS)
Recombinant E. coli 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: aroA. Target Synonyms: 5-enolpyruvylshikimate-3-phosphate synthase (EPSP synthase, EPSPS). Accession Number: P0A6D3. Expression Region: 1~427aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MESLTLQPIARVDGTINLPGSKSVSNRALLLAALAHGKTVLTNLLDSDDVRHMLNALTALGVSYTLSADRTRCEIIGNGGPLHAEGALELFLGNAGTAMRPLAAALCLGSNDIVLTGEPRMKERPIGHLVDALRLGGAKITYLEQENYPPLRLQGGFTGGNVDVDGSVSSQFLTALLMTAPLAPEDTVIRIKGDLVSKPYIDITLNLMKTFGVEIENQHYQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAI
Target-Kategorie: aroA