Recombinant Bubalus bubalis Lingual antimicrobial peptide is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bubalus bubalis (Domestic water buffalo). Target Name: Bubalus bubalis Lingual antimicrobial peptide. Target Synonyms: Lingual antimicrobial peptide. Accession Number: A3RJ36. Expression Region: 25~64aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht:
19.8kDa
Tag:
N-Terminal 6Xhis-Ksi-Tagged
Puffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit:
>85% by SDS-PAGE
Sequenz:
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Target-Kategorie:
Bubalus bubalis Lingual antimicrobial peptide
* Mehrwertsteuer und Versandkosten nicht enthalten. Irrtümer und Preisänderungen vorbehalten
