Recombinant Leishmania infantum Thymine dioxygenase JBP1 (JBP1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27692
Artikelname: Recombinant Leishmania infantum Thymine dioxygenase JBP1 (JBP1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27692
Hersteller Artikelnummer: RPC27692
Alternativnummer: BIM-RPC27692-20UG,BIM-RPC27692-100UG,BIM-RPC27692-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: J-binding protein 1, Thymidine hydroxylase JBP1
Recombinant Leishmania infantum Thymine dioxygenase JBP1 (JBP1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Leishmania infantum. Target Name: JBP1. Target Synonyms: J-binding protein 1, Thymidine hydroxylase JBP1. Accession Number: A4HU70. Expression Region: 200~600aa. Tag Info: N-Terminal 10Xhis-V5-Tagged. Theoretical MW: 53.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.4kDa
Tag: N-Terminal 10Xhis-V5-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SCIACLDGQFKGLALAFDDFGINVLMQPRDVMIFDSHHFHSNTEVELSFSGEDWKRLTCVFYYRAALGEPASYAEYRRRLEKSKQDTSFTPVVSNVRVKENGTNLNRPSPVYPIFLSPFWVPMVAHCLQHCASEAQCVHDAMTADGSRLAEVMFGEPLSTSDGIPLRGEEEKLKANSDSASRPLSRLGGFSETNLMVSTAVEKKKYLNSEFLSHFISAQLLDMWKQARGKWLELVGREWTHMLALNPERKDFLWR
Target-Kategorie: JBP1