Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27698
Artikelname: Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27698
Hersteller Artikelnummer: RPC27698
Alternativnummer: BIM-RPC27698-20UG,BIM-RPC27698-100UG,BIM-RPC27698-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: P30
Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Toxoplasma gondii. Target Name: GRA3. Target Synonyms: P30. Accession Number: B6KEU8. Expression Region: 43~114aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 10.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK
Target-Kategorie: GRA3