Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM), Unconjugated, E. coli

Artikelnummer: BIM-RPC27704
Artikelname: Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM), Unconjugated, E. coli
Artikelnummer: BIM-RPC27704
Hersteller Artikelnummer: RPC27704
Alternativnummer: BIM-RPC27704-20UG,BIM-RPC27704-100UG,BIM-RPC27704-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Autolysin LytM
Recombinant Staphylococcus aureus Glycyl-glycine endopeptidase lytM (lytM) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain NCTC 8325). Target Name: lytM. Target Synonyms: Autolysin LytM. Accession Number: O33599. Expression Region: 26~316aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 35.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 35.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AETTNTQQAHTQMSTQSQDVSYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKVNYPNGTSNQNGGSASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAY
Target-Kategorie: lytM