Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27706
Artikelname: Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27706
Hersteller Artikelnummer: RPC27706
Alternativnummer: BIM-RPC27706-20UG,BIM-RPC27706-100UG,BIM-RPC27706-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: ATP-polyphosphate phosphotransferase 2Polyphosphoric acid kinase 2
Recombinant Chlorobium tepidum Polyphosphate kinase 2 (ppk2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum). Target Name: ppk2. Target Synonyms: ATP-polyphosphate phosphotransferase 2Polyphosphoric acid kinase 2. Accession Number: O68984. Expression Region: 140~343aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 34.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 34.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EQQQLLQHYFRKEVFPVLTPLAFDTGHPFPFMSNLSLNLAIELEDEESGAIKFARVKVPGILSRIIRLDQIEGLGFDDGRIRLLWLEDLVEHNLDQLFPKMRILQCHPFRIIRDADIEIEEDEAGDLLESIEQGVRSRRYGKVVRLDINPDMPHSIRSLLVKNLETYERNVYEIGGVLGMSALMELLKIDRPDLKDELFVPNNP
Target-Kategorie: ppk2