Recombinant Yersinia pestis bv. Antiqua Small heat shock protein ibpA (ibpA), Unconjugated, E. coli

Artikelnummer: BIM-RPC27715
Artikelname: Recombinant Yersinia pestis bv. Antiqua Small heat shock protein ibpA (ibpA), Unconjugated, E. coli
Artikelnummer: BIM-RPC27715
Hersteller Artikelnummer: RPC27715
Alternativnummer: BIM-RPC27715-20UG,BIM-RPC27715-100UG,BIM-RPC27715-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: 16 kDa heat shock protein A
Recombinant Yersinia pestis bv. Antiqua Small heat shock protein ibpA (ibpA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Yersinia pestis bv. Antiqua (strain Nepal516). Target Name: ibpA. Target Synonyms: 16 kDa heat shock protein A. Accession Number: Q1CD74. Expression Region: 1~137aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDENNYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEHIKIKGANLVNGLLYIDLERLVPESLKPRRIEIK
Target-Kategorie: ibpA