Recombinant Human Cyclin-dependent kinase 5 activator 1 (CDK5R1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27719
Artikelname: Recombinant Human Cyclin-dependent kinase 5 activator 1 (CDK5R1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27719
Hersteller Artikelnummer: RPC27719
Alternativnummer: BIM-RPC27719-20UG,BIM-RPC27719-100UG,BIM-RPC27719-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cyclin-dependent kinase 5 activator 1(CDK5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, TPKII regulatory subunit) [Cleaved into: Cyclin-dependent kinase 5 activator 1, p35(p35), Cyclin-dependent kinase 5 activator 1, p25(p25, Tau protein kinase II 23 kDa subunit, p23)]
Recombinant Human Cyclin-dependent kinase 5 activator 1 (CDK5R1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CDK5R1. Target Synonyms: Cyclin-dependent kinase 5 activator 1(CDK5 activator 1, Cyclin-dependent kinase 5 regulatory subunit 1, TPKII regulatory subunit) [Cleaved into: Cyclin-dependent kinase 5 activator 1, p35(p35). Accession Number: Q15078. Expression Region: 99~307aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.3kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Target-Kategorie: CDK5R1