Recombinant Bovine ATP synthase subunit g, mitochondrial (ATP5MG), Unconjugated, E. coli

Artikelnummer: BIM-RPC27720
Artikelname: Recombinant Bovine ATP synthase subunit g, mitochondrial (ATP5MG), Unconjugated, E. coli
Artikelnummer: BIM-RPC27720
Hersteller Artikelnummer: RPC27720
Alternativnummer: BIM-RPC27720-20UG,BIM-RPC27720-100UG,BIM-RPC27720-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: ATP synthase membrane subunit g (ATPase subunit g, ATP5L)
Recombinant Bovine ATP synthase subunit g, mitochondrial (ATP5MG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: ATP5MG. Target Synonyms: ATP synthase membrane subunit g (ATPase subunit g, ATP5L). Accession Number: Q28852. Expression Region: 2~103aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
Target-Kategorie: ATP5MG