Recombinant Helianthus annuus Non-specific lipid-transfer protein, Unconjugated, E. coli

Artikelnummer: BIM-RPC27727
Artikelname: Recombinant Helianthus annuus Non-specific lipid-transfer protein, Unconjugated, E. coli
Artikelnummer: BIM-RPC27727
Hersteller Artikelnummer: RPC27727
Alternativnummer: BIM-RPC27727-20UG,BIM-RPC27727-100UG,BIM-RPC27727-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: LTP, NsLTP, SDI-9
Recombinant Helianthus annuus Non-specific lipid-transfer protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helianthus annuus (Common sunflower). Target Name: Helianthus annuus Non-specific lipid-transfer protein. Target Synonyms: LTP, NsLTP, SDI-9. Accession Number: Q39950. Expression Region: 26~116aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 16.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: LSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ
Target-Kategorie: Helianthus annuus Non-specific lipid-transfer protein