Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 1 (hmw1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27735
Artikelname: Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 1 (hmw1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27735
Hersteller Artikelnummer: RPC27735
Alternativnummer: BIM-RPC27735-20UG,BIM-RPC27735-100UG,BIM-RPC27735-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Cytadherence accessory protein 1
Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 1 (hmw1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Target Name: hmw1. Target Synonyms: Cytadherence accessory protein 1. Accession Number: Q50365. Expression Region: 1~139aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MKKSKEAVFEDKDYTEENPEQIFGNLYDGKLTVQDGKVKIAYDGDGNGYYIAFNSETGVYYDPYGDTEYDISVLFDANGNSFVFADAPTVEVLAGEQEQTEAEPDYLQYVGNEAYGYYDEAGEWVWSGY
Target-Kategorie: hmw1