Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27763
Artikelname: Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27763
Hersteller Artikelnummer: RPC27763
Alternativnummer: BIM-RPC27763-20UG,BIM-RPC27763-100UG,BIM-RPC27763-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Clec4g. Accession Number: Q8BNX1. Expression Region: 52~294aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: LLSSASSKLRVLLSHQDLLRTNASEQKMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQCPPSWLPFQGSCYYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICEKRSSCY
Target-Kategorie: Clec4g