Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27767
Artikelname: Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27767
Hersteller Artikelnummer: RPC27767
Alternativnummer: BIM-RPC27767-20UG,BIM-RPC27767-100UG,BIM-RPC27767-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: G-protein coupled receptor family C group 5 member A, Phorbol ester induced gene 1, PEIG-1, Retinoic acid-induced gene 1 protein, RAIG-1
Recombinant Human Retinoic acid-induced protein 3 (GPRC5A), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GPRC5A. Target Synonyms: G-protein coupled receptor family C group 5 member A, Phorbol ester induced gene 1, PEIG-1, Retinoic acid-induced gene 1 protein, RAIG-1. Accession Number: Q8NFJ5. Expression Region: 269~357aa. Tag Info: N-Terminal Gst-Tagged. Theoretical MW: 37.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.0kDa
Tag: N-Terminal Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Target-Kategorie: GPRC5A