Recombinant Human Fructose-bisphosphate aldolase C (ALDOC), Unconjugated, E. coli

Artikelnummer: BIM-RPC28733
Artikelname: Recombinant Human Fructose-bisphosphate aldolase C (ALDOC), Unconjugated, E. coli
Artikelnummer: BIM-RPC28733
Hersteller Artikelnummer: RPC28733
Alternativnummer: BIM-RPC28733-20UG,BIM-RPC28733-100UG,BIM-RPC28733-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Fructose-bisphosphate aldolase C(EC 4.1.2.13, Brain-type aldolase)
Recombinant Human Fructose-bisphosphate aldolase C (ALDOC) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ALDOC. Target Synonyms: Fructose-bisphosphate aldolase C(EC 4.1.2.13, Brain-type aldolase). Accession Number: P09972. Expression Region: 1~364aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 43.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 43.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVT
Target-Kategorie: ALDOC