Recombinant Mouse Appetite-regulating hormone (Ghrl), Unconjugated, E. coli

Artikelnummer: BIM-RPC28734
Artikelname: Recombinant Mouse Appetite-regulating hormone (Ghrl), Unconjugated, E. coli
Artikelnummer: BIM-RPC28734
Hersteller Artikelnummer: RPC28734
Alternativnummer: BIM-RPC28734-20UG,BIM-RPC28734-100UG,BIM-RPC28734-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Appetite-regulating hormone(Growth hormone secretagogue, Growth hormone-releasing peptide, Motilin-related peptide, Protein M46) [Cleaved into: Ghrelin, Obestatin]
Recombinant Mouse Appetite-regulating hormone (Ghrl) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ghrl. Target Synonyms: Appetite-regulating hormone(Growth hormone secretagogue, Growth hormone-releasing peptide, Motilin-related peptide, Protein M46) [Cleaved into: Ghrelin, Obestatin]. Accession Number: Q9EQX0. Expression Region: 24~117aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 14.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK
Target-Kategorie: Ghrl