Recombinant Human Lipopolysaccharide-binding protein (LBP), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28739
Artikelname: Recombinant Human Lipopolysaccharide-binding protein (LBP), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28739
Hersteller Artikelnummer: RPC28739
Alternativnummer: BIM-RPC28739-20UG,BIM-RPC28739-100UG,BIM-RPC28739-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Lipopolysaccharide-binding protein(LBP)
Recombinant Human Lipopolysaccharide-binding protein (LBP), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LBP. Target Synonyms: Lipopolysaccharide-binding protein(LBP). Accession Number: P18428. Expression Region: 304~414aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 47.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 47.4kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES
Target-Kategorie: LBP