Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28740
Artikelname: Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28740
Hersteller Artikelnummer: RPC28740
Alternativnummer: BIM-RPC28740-20UG,BIM-RPC28740-100UG,BIM-RPC28740-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3, ITI-HC3, Inter-alpha-inhibitor heavy chain 3, Serum-derived hyaluronan-associated protein, SHAP)
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ITIH3. Target Synonyms: Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3, ITI-HC3, Inter-alpha-inhibitor heavy chain 3, Serum-derived hyaluronan-associated protein, SHAP). Accession Number: Q06033. Expression Region: 512~651aa. Tag Info: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 51.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 51.2kDa
Tag: N-Terminal 10Xhis-Gst-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD
Target-Kategorie: ITIH3