Recombinant Mouse Neuron navigator 3 (Nav3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC28741
Artikelname: Recombinant Mouse Neuron navigator 3 (Nav3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC28741
Hersteller Artikelnummer: RPC28741
Alternativnummer: BIM-RPC28741-20UG,BIM-RPC28741-100UG,BIM-RPC28741-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Neuron navigator 3(Pore membrane and/or filament-interacting-like protein 1)
Recombinant Mouse Neuron navigator 3 (Nav3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Nav3. Target Synonyms: Neuron navigator 3(Pore membrane and/or filament-interacting-like protein 1). Accession Number: Q80TN7. Expression Region: 77~184aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EDSKIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLADIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILGLFFSLSRYKQ
Target-Kategorie: Nav3